PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G413000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB_related
Protein Properties Length: 303aa    MW: 32934.3 Da    PI: 8.8471
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G413000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rW+++E+e+++da  ++G + Wk+I +++  ++t  q++s+ qky
  Brast01G413000.1.p 24 RERWSPDEHERFLDAMLRFGRD-WKKIEEHVR-TKTTVQIRSHAQKY 68
                        78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-161874IPR009057Homeodomain-like
PROSITE profilePS5129417.5241973IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-92175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-162371IPR006447Myb domain, plants
SMARTSM007177.6E-102371IPR001005SANT/Myb domain
PfamPF002494.5E-132468IPR001005SANT/Myb domain
CDDcd001673.59E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEQTPPGPGA GKKARKPYTI SRPRERWSPD EHERFLDAML RFGRDWKKIE EHVRTKTTVQ  60
IRSHAQKYFL KVQKLGLAAG QHPFRRIGMA QLQSTQGPAA GSGAVPGPMM VLHGQPQECP  120
PGVLLQSSIG WRWSCPGLLP APNDMQSLNW ESSSGHSSAW VSHGGNQPEP TAATHPGGSP  180
SSSSSMGAPS FGNTSMDWAG TGSATQAWAI SGAEDDTIPL PLSPDDMHFA QVYRFVGDVF  240
DPATPCQMEA HLQRLKDMDA ITVKTILLVL RNLEANLTAP QFEPIRRLLS RYDPGRALSG  300
QL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227459.11e-166PREDICTED: protein REVEILLE 5-like
TrEMBLA0A0Q3H4R91e-166A0A0Q3H4R9_BRADI; Uncharacterized protein
STRINGORGLA01G0032300.11e-124(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02840.34e-39LHY/CCA1-like 1